PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00010266-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family GRAS
Protein Properties Length: 524aa    MW: 58338.7 Da    PI: 5.1901
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00010266-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS435.44.2e-1331555242374
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                            ++ L+ecA +v++gd+++a+++++ l++++s +gdp +R+aay++eAL ar+a s+ +ly+al+++e++   ss++l+a+++++ev+P
  SMil_00010266-RA_Salv 155 KHMLFECAAVVHNGDFKRASSMISVLRQHVSIQGDPSERIAAYMVEALVARIAASGRGLYRALKCKEAP---SSDRLSAMQVLFEVCP 239
                            589*****************************************************************9...9*************** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                            +++f++++aN aIlea+  e+rvHi+Dfd++qG Q+ +Llq+La+ +++ p++R+Tgv++pes+      l+ +g+rL+ +A++l+++
  SMil_00010266-RA_Salv 240 CFRFGFMAANGAILEAFRDEKRVHIVDFDVNQGSQYYTLLQTLANTSGDRPHVRLTGVDDPESVqrPVGGLKIIGQRLELLAKQLHLS 327
                            **************************************************************99888899****************** PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                            fef++ v  +++ ++++ L+++pgEal+Vn+++qlh+l+desvs+ + rd++L+++k+l+Pk+v+vveq++++n+++F +rf+ea +y
  SMil_00010266-RA_Salv 328 FEFKA-VPAETALVSPSVLDCRPGEALVVNFAFQLHHLPDESVSTVNLRDQLLRMIKGLKPKLVTVVEQDMNTNTSPFPQRFAEAYNY 414
                            *****.7999****************************************************************************** PP

                   GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                            ysa+f+sl+a+l+res++r++vE+++l+r+i nvvaceg+er+er e ++kWr+r+++aGF++  +s ++ ++++ l+++++++ y+v
  SMil_00010266-RA_Salv 415 YSAVFESLDATLARESQDRMNVEKHCLARDIINVVACEGEERIERYEVAGKWRSRMTMAGFTACGISWNVRSEIEKLIQQYSER-YKV 501
                            **********************************************************************************66.*** PP

                   GRAS 352 eeesgslvlgWkdrpLvsvSaWr 374
                            +ee+g+l +gW++++L++ SaWr
  SMil_00010266-RA_Salv 502 KEEKGALHFGWEEKTLIVSSAWR 524
                            **********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.955128505IPR005202Transcription factor GRAS
PfamPF035141.5E-130155524IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MSLVGSAALF RSPEPYSLKD DIDSSGLSTS GFYSYSSDSY DPKYFLDSPS SSDVLGHQIQ  60
SSSSQHSSGE NPFQSSLGFD YASELDSPRN IDYDEDKLNL KLQELEKALL DDNAATMEID  120
GNFLDSPKES SSSDSNLSST TSGKEMVISG PLSRKHMLFE CAAVVHNGDF KRASSMISVL  180
RQHVSIQGDP SERIAAYMVE ALVARIAASG RGLYRALKCK EAPSSDRLSA MQVLFEVCPC  240
FRFGFMAANG AILEAFRDEK RVHIVDFDVN QGSQYYTLLQ TLANTSGDRP HVRLTGVDDP  300
ESVQRPVGGL KIIGQRLELL AKQLHLSFEF KAVPAETALV SPSVLDCRPG EALVVNFAFQ  360
LHHLPDESVS TVNLRDQLLR MIKGLKPKLV TVVEQDMNTN TSPFPQRFAE AYNYYSAVFE  420
SLDATLARES QDRMNVEKHC LARDIINVVA CEGEERIERY EVAGKWRSRM TMAGFTACGI  480
SWNVRSEIEK LIQQYSERYK VKEEKGALHF GWEEKTLIVS SAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-5617352422375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101898.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101891.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101887.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101883.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A068UU850.0A0A068UU85_COFCA; Uncharacterized protein
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1